DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swif and CG8701

DIOPT Version :9

Sequence 1:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster


Alignment Length:291 Identity:84/291 - (28%)
Similarity:111/291 - (38%) Gaps:82/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FRSFATKAQG--FRSFASKVTYHADPPCQPVDPLCH------HVPSGRCVQARETINLKLPHERL 69
            :||..||.|.  ..||||.|              ||      |.||.:|                
  Fly     4 WRSIGTKTQNRVIPSFASVV--------------CHRAFAKDHNPSPKC---------------- 38

  Fly    70 LKQERDQKKERKCCVLRSAAKNPCVEIRRPKAAKLEEKPFRSMWEPPCKANEQPFCKEMLPRFDA 134
                  .....|.|...:|..:|.. .::|...|.:...|..:.:.|.:....| |.|..|.:|.
  Fly    39 ------SDSSGKGCGNFTACGDPRF-AKKPPPKKEDGFQFHHLVKQPPECCTDP-CAERFPPYDQ 95

  Fly   135 MYYHPSNKC-RCYQRTWVECSPVKKRLKKVCCLDAIEPPEILYRIRPPCP----------GTCQI 188
            .||..|:|. |.||.|||||.|:|.:.||:||.:|        .||||.|          ..|..
  Fly    96 CYYKISDKATRKYQVTWVECPPIKIKPKKICCYEA--------GIRPPIPRRKRKKFVTSAECPT 152

  Fly   189 NYKARRLLCADGEWERDPTR--KCPKFFHPCCKLARCNPRCSRGRKPTLCTKLRAPYPCYSEKIR 251
            |.:.             ||.  .||:...|.|| |..:..|...|:.|.|.|::||||.:||..|
  Fly   153 NVEC-------------PTEGGPCPRIKMPGCK-AVDSVSCHVVRRKTDCVKVKAPYPSFSECSR 203

  Fly   252 G-TRPLRKRECLCLETTPKCIALAERMRRDG 281
            . .|..|..||.||:....|..:.|..:.:|
  Fly   204 SRLRKPRGVECNCLDVPSSCDLIRELKKFEG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swifNP_001097231.1 DUF1431 121..278 CDD:284625 59/170 (35%)
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 59/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FCF2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.