DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swif and CG33340

DIOPT Version :9

Sequence 1:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster


Alignment Length:218 Identity:71/218 - (32%)
Similarity:95/218 - (43%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QKKERKCCVLRSAAKNPC--VEIRRPKAAKLEEKPFRSMW-EPPCKANEQ--PFCKEMLPRFDAM 135
            :||....|. :...|.||  ..::.|...|.:....:||| .|.|..::.  ||    .||||.:
  Fly    30 EKKGPSRCP-KVLTKFPCGKPNLQAPPKKKRKMVKAQSMWLNPFCDPDDTACPF----NPRFDDI 89

  Fly   136 YYHPSNKC-RCYQRTWVECSPVKKRLKKVCCLDAIEPPEILYR---IRP--PCPGTCQINYKARR 194
            ||..|:|. |.|.:|||.|.|::.:.||:||....:|..|..|   .:|  .||..|.       
  Fly    90 YYVESDKAKRKYWQTWVACPPIQIKPKKICCFAKAKPAPIKRRKPSAKPSTACPQPCP------- 147

  Fly   195 LLCADGEWERDPTRK-CPKFFHPCCKLARCNPRCSRGRKPTLCTKLRAPYPCYSE--KIRGTRPL 256
                      ||:.. ||:....|.:..|..|.|.|.|.|..|.|.|.|||.:||  :::...|.
  Fly   148 ----------DPSEDLCPRLARRCHRDGRRPPSCRRERGPLPCVKPRTPYPSFSECRRLKPDAPP 202

  Fly   257 RKRECLCLETTPKCIALAERMRR 279
            .| ||.||.....|...||..||
  Fly   203 LK-ECNCLAKPLLCEIWAEFRRR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swifNP_001097231.1 DUF1431 121..278 CDD:284625 56/167 (34%)
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 57/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FCF2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.