DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and CG12861

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster


Alignment Length:297 Identity:78/297 - (26%)
Similarity:118/297 - (39%) Gaps:85/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNSLAKRIVLMPSLIALE-----DTCRTIHVTALMARMGKDFCPVSEVPDCKVVKKRPCSPTDP 60
            :|.::.:.:::..||.:|.     ||.:.:::........|:...:.|:  |.....|......|
  Fly     3 VLQTVQRTLLMQHSLGSLTIKRTYDTVKKMNLRRRRLEHLKELKRLDEM--CYKAASRNDKKCHP 65

  Fly    61 PVRPCSEEGCTQPRYSCCVSTGISANPCADPSKKTKFVSMWKRYKDDGSNRPEAMWHYPEECCPK 125
            ||.|.       |:..|.      .:|||:                  |..|             
  Fly    66 PVLPL-------PKMECI------DDPCAE------------------SEMP------------- 86

  Fly   126 CEDTRFDVLYYTPSDK-CREFQRTWWEC--CPKMVPKRVCCWCDAIPPEVLRRDLPICPRSACL- 186
                 .|:.:|||||| .|::||||.||  .||...|...|:     |...||... |||.:.: 
  Fly    87 -----LDLDHYTPSDKAARKYQRTWCECYMIPKAAVKARKCY-----PNRPRRKFE-CPRVSDVE 140

  Fly   187 -------AEHERKRYKCLNKRYK----GCMRIRMPCCRTARIPPDCRAFPGPSDCEKIKCPFPSY 240
                   .:..:|:.:.|.:..:    .|.:|..|.||..||||.|.|...|:.|:|.:..:||:
  Fly   141 CRWDPMPCDDVKKKPEILIEVPRIGKWPCCKIPTPGCRDGRIPPSCDAGRIPTCCKKRRTKYPSF 205

  Fly   241 SECVQE--DPAVIPTRPPECECLKKASQCEQIRRGRH 275
            |||.:|  ||.      |.|||.||.:.|:.....||
  Fly   206 SECKKELLDPI------PPCECEKKVNMCDVYAYFRH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 55/165 (33%)
CG12861NP_610978.2 DM6 74..235 CDD:214775 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.