DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and CG8701

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster


Alignment Length:252 Identity:77/252 - (30%)
Similarity:108/252 - (42%) Gaps:59/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VVKKRPCSPTDPPVRPCSE---EGCTQPRYSCCVSTGISANPCADPSKKTKFVSMWKRYKDDGSN 110
            ||..|..:....|...||:   :||.            :...|.||    :|.......|:||  
  Fly    22 VVCHRAFAKDHNPSPKCSDSSGKGCG------------NFTACGDP----RFAKKPPPKKEDG-- 68

  Fly   111 RPEAMWHY----PEECCPKCEDTRF---DVLYYTPSDKC-REFQRTWWECCP-KMVPKRVCCWCD 166
               ..:|:    |.|||......||   |..||..|||. |::|.||.||.| |:.||::||:..
  Fly    69 ---FQFHHLVKQPPECCTDPCAERFPPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCYEA 130

  Fly   167 AIPPEVLRRDLPICPRSACLAEHERKRY----KC---LNKRYKG--CMRIRMPCCRTARIPPDCR 222
            .|.|.:.||              :||::    :|   :....:|  |.||:||.|: |.....|.
  Fly   131 GIRPPIPRR--------------KRKKFVTSAECPTNVECPTEGGPCPRIKMPGCK-AVDSVSCH 180

  Fly   223 AFPGPSDCEKIKCPFPSYSECVQEDPAVIPTRPPECECLKKASQCEQIRRGRHMENN 279
            .....:||.|:|.|:||:|||.:.  .:...|..||.||...|.|:.||..:..|.|
  Fly   181 VVRRKTDCVKVKAPYPSFSECSRS--RLRKPRGVECNCLDVPSSCDLIRELKKFEGN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 55/162 (34%)
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 57/166 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.