DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and CG2127

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster


Alignment Length:318 Identity:90/318 - (28%)
Similarity:133/318 - (41%) Gaps:69/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNSLAKRIV--LMPSLIALEDTCRTIHVTALMARMGKDFCPVSEVPDC--------KVVKKRPC 55
            ||....:.:|  .||.|.:|.:.|....|.     ..|:...:....||        .::::...
  Fly     4 MLRQKCRSLVDRSMPCLESLVNACSLFKVD-----WSKNLSQIKTPADCVGSSVLRQHLLRRNYS 63

  Fly    56 SPTDPPVRPCSEEGCTQPRYSCCVSTGISANPCADPSKKTKFVSMWKRY-----KDDGSNRPE-- 113
            |.:       |.:.|.:|:....|||.....|..........|...||.     |.:.||:|:  
  Fly    64 SQS-------SADDCGRPKDCDQVSTSKGCGPARFKGTICDAVKGGKRKKKEEPKKEKSNKPKLP 121

  Fly   114 ----AMWHYPE-ECCPKCE-DTRFDVLYYTPSDK-CREFQRTWWECCPKMV--PKRVCCWCDAIP 169
                :||:.|: |..|||: ..|:|:.:|..||| .|::|.||.| ||::|  ||:||.......
  Fly   122 AKMRSMWYIPDCEYVPKCDVPVRYDIQHYRISDKEARQYQVTWNE-CPRLVIKPKKVCIHAKRPR 185

  Fly   170 PEVLRRD-----------LPICPRSACLAEHERKRYKCLNKRYKGCMRIRMPCCRTARIPPDCRA 223
            |:..||.           :|:.....|....:.          ..|.|..:|||:.|||||.|..
  Fly   186 PKPCRRQRKTVVATARPTMPMLNPMECKKAEDS----------SPCPRWTLPCCKPARIPPSCHR 240

  Fly   224 FPGPSDCEKIKCPFPSYSECVQEDPAVIPTRPPECECLKKASQCE-------QIRRGR 274
            ...|:||.|...|:||:|||.:|:....|  |.||.||:....||       :|.||:
  Fly   241 ERRPTDCTKRPAPYPSFSECKREELTNAP--PTECLCLRVPMACEMWAELRRRIARGK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 57/171 (33%)
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 57/169 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.