DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and boly

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster


Alignment Length:286 Identity:81/286 - (28%)
Similarity:115/286 - (40%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSLAKRIVLMPSLIALEDTCRTIHVTALMARMGKDFCP--------VSEVPDCKVVKKRPCSPTD 59
            |:|::..|.:.|.:    |.|||.|     ||...|.|        .:|..|.|  |..|...|.
  Fly     6 NTLSRAPVAIRSGL----TSRTIQV-----RMESLFDPYEFGAPTMATERKDLK--KNDPADNTK 59

  Fly    60 PPVRPCSEEGCTQPRYSCCVSTGISANPCADPS-KKTKFVSMWKRYKDDGSNRPEAMWHYPEECC 123
            .||:........:..|.|          .:||. ....|:...||...|     .....||..  
  Fly    60 VPVKDICWMSMRRSEYKC----------RSDPEFNVPAFIDSRKRCLSD-----RCAMAYPPS-- 107

  Fly   124 PKCEDTRFDVLYYTPSDKC-REFQRTWWECCPKMVPKRVCCWCDAIPPEVLRRD---LPICPRSA 184
                    |:::|.|:||. |::||||.||  ::..::....|.:.||::.||.   ||:.|...
  Fly   108 --------DLMFYKPTDKLNRKYQRTWCEC--ELQERKRKAVCRSRPPKIHRRSLRTLPLHPSKV 162

  Fly   185 CLAEHERKRYK------CLNKRYK-GCMRIRMPCCRTARIPPDCRAFPGPSDCEKIKCPFPSYSE 242
            |     .|..|      |..|..| .|.|.:||.|:.| |...||....||:|.:.:..:||:||
  Fly   163 C-----SKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQA-ITTGCRPGRPPSNCVRPRTKYPSFSE 221

  Fly   243 CVQEDPAVIPTRPP-ECECLKKASQC 267
            |   .|..:|..|| .|.|:.:...|
  Fly   222 C---QPYPLPDVPPTHCFCINQPPMC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 50/154 (32%)
bolyNP_610373.2 DM6 94..251 CDD:214775 54/177 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.