DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and CG11635

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster


Alignment Length:251 Identity:85/251 - (33%)
Similarity:103/251 - (41%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KRPCSPTDPPVRPCSEEGCTQPRYSCCVSTGISANPCADPSKKTKFVSMWKRYKDDGSNRPEAMW 116
            |.|.||: ||..|.::..| :.|..|     |.|..||:..   ||.|||    |...|.|..  
  Fly    29 KPPSSPS-PPKSPSAKREC-KIRTHC-----IPAAFCAEGD---KFKSMW----DPPKNLPPP-- 77

  Fly   117 HYP-------EECC-PKCED--TRFDVLYYTPSDKCREFQRTWWECCPKMVPKRVCCWCDAIPPE 171
             ||       :.|| |.|..  ..||.|||.||.|...:||.|.||...|:.|::.|..|.:  |
  Fly    78 -YPFVVSRSNDLCCEPNCTKPLPSFDELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKL--E 139

  Fly   172 VLRRDLPICPRSACLAEHERKRYKCLNKRYKGCMRIRMPC--------CRTARIPPDCRAFPGPS 228
            .|         |......||:....|:....|      ||        |...|.||.|.|...||
  Fly   140 AL---------SPARRVAERRERTTLSATATG------PCPHFAPLARCVPGRRPPRCHAAKTPS 189

  Fly   229 DCEKIKCPFPSYSECVQEDPAVIPTRPPECECLKKASQCEQIRRGR-----HMENN 279
            .|.::..|.|.:|:|.|...|..|.||.||||....|.|| ..|||     |.||:
  Fly   190 CCRRLCAPMPCWSDCKQPKLAKRPYRPRECECRFPLSLCE-AERGRQWVKIHGENH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 55/163 (34%)
CG11635NP_610372.1 DM6 88..235 CDD:214775 57/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.