DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and CG4691

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_609719.1 Gene:CG4691 / 34856 FlyBaseID:FBgn0028870 Length:262 Species:Drosophila melanogaster


Alignment Length:202 Identity:67/202 - (33%)
Similarity:86/202 - (42%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDDGSNRPEAMWHYPEECCPKCE-----------DTR--------------FDVLYYTPSDK-CR 143
            |.|.|...:|.|........||.           |:|              .|:.:|.|||. .|
  Fly    62 KKDRSKVYDACWQTTRRTEYKCRSDPEFQMHAFIDSRKSCLEDPCATEMLAIDLTHYKPSDMGKR 126

  Fly   144 EFQRTWWECCPKMVPKRVCCWCDAIPPEVLRR----DLPICPRSAC-LAEHERKRYKCLNKRYKG 203
            ::.|||:||..|...::  ..|..:||.:.||    ..|.||...| |.:.|....|...|....
  Fly   127 KYPRTWFECVVKRRKRK--AHCVPVPPPMPRRKRKSKKPRCPEDLCVLGKLELNLIKPCVKESSK 189

  Fly   204 CMRIRMP-CCRTARIPPDCRAFPGPSDCEKIKCPFPSYSECVQEDPAVIPTRPPECECLKKASQC 267
            |.|.||| ||..||.||.||. |.....::.|..:||:||| :.||...| ||.||.||.|.:.|
  Fly   190 CPRFRMPNCCVAARDPPKCRR-PFRRCGQRPKTKYPSFSEC-RRDPFPDP-RPIECNCLLKPAIC 251

  Fly   268 EQIRRGR 274
            :..|..|
  Fly   252 DMWRHYR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 61/181 (34%)
CG4691NP_609719.1 DM6 100..258 CDD:214775 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.