DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hubl and swif

DIOPT Version :9

Sequence 1:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:117/260 - (45%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PCSPTDPPVRPCSEEGCTQPRYS----------------------CCVSTGISANPCADPSKKTK 96
            ||.|.||.........|.|.|.:                      |||....:.|||.: .::.|
  Fly    37 PCQPVDPLCHHVPSGRCVQARETINLKLPHERLLKQERDQKKERKCCVLRSAAKNPCVE-IRRPK 100

  Fly    97 FVSMWKRYKDDGSNRP-EAMWHYPEECC-----PKCED--TRFDVLYYTPSDKCREFQRTWWECC 153
            ...:        ..:| .:||..|   |     |.|::  .|||.:||.||:|||.:||||.||.
  Fly   101 AAKL--------EEKPFRSMWEPP---CKANEQPFCKEMLPRFDAMYYHPSNKCRCYQRTWVECS 154

  Fly   154 P-KMVPKRVCCWCDAI-PPEVLRRDLPICPRSACLAEHERKRYKCLNKRY-----KGCMRIRMPC 211
            | |...|:||| .||| |||:|.|..|.|| ..|...::.:|..|.:..:     :.|.:...||
  Fly   155 PVKKRLKKVCC-LDAIEPPEILYRIRPPCP-GTCQINYKARRLLCADGEWERDPTRKCPKFFHPC 217

  Fly   212 CRTARIPPDCRAFPGPSDCEKIKCPFPSYSECVQEDPAVIPTRPPECECLKKASQC----EQIRR 272
            |:.||..|.|.....|:.|.|::.|:|.|||.::   ...|.|..||.||:...:|    |::||
  Fly   218 CKLARCNPRCSRGRKPTLCTKLRAPYPCYSEKIR---GTRPLRKRECLCLETTPKCIALAERMRR 279

  Fly   273  272
              Fly   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hublNP_001286194.1 DUF1431 126..275 CDD:284625 63/160 (39%)
swifNP_001097231.1 DUF1431 121..278 CDD:284625 62/161 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.