DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cola and CG8701

DIOPT Version :9

Sequence 1:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster


Alignment Length:241 Identity:67/241 - (27%)
Similarity:96/241 - (39%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSGECCKMRDKDTTACKDGKWFCPVKYEPNKCYEKPSFAVEEYSQYLQEIYNRGKTNPDCLL--- 92
            |||:.|    .:.|||.|.::           .:||....|:..|:    ::..|..|:|..   
  Fly    41 SSGKGC----GNFTACGDPRF-----------AKKPPPKKEDGFQF----HHLVKQPPECCTDPC 86

  Fly    93 --KLIRHDAEHYKPSDK-QRKFQRTWPECPLLWLRPKDYCCPDQEVYQPMNRRIR---------- 144
              :...:|..:||.||| .||:|.||.|||.:.::||..||.:..:..|:.||.|          
  Fly    87 AERFPPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCYEAGIRPPIPRRKRKKFVTSAECP 151

  Fly   145 -----PPQEPPLSAIEKHLFQMSIFCKSVRAPCCKVGRRPPKCTKPRRPSECCKKFTPMPSFSEA 204
                 |.:..|              |..::.|.|| ......|...||.::|.|...|.|||||.
  Fly   152 TNVECPTEGGP--------------CPRIKMPGCK-AVDSVSCHVVRRKTDCVKVKAPYPSFSEC 201

  Fly   205 CRHLIPRFCGSECACRG-GSLCEMWNTYNMCNKSRRNCTKPLIGYS 249
            .|..:.:..|.||.|.. .|.|::   .....|...|..||..|.|
  Fly   202 SRSRLRKPRGVECNCLDVPSSCDL---IRELKKFEGNPRKPNCGGS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
colaNP_724673.1 DM6 84..232 CDD:214775 49/169 (29%)
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 47/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FCF2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.