DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cola and CG4691

DIOPT Version :9

Sequence 1:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_609719.1 Gene:CG4691 / 34856 FlyBaseID:FBgn0028870 Length:262 Species:Drosophila melanogaster


Alignment Length:211 Identity:70/211 - (33%)
Similarity:93/211 - (44%) Gaps:30/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MRDKDTTACKDGKWFCPVKYEPNKCYEKPSFAVEEYSQYLQEIYNRGKTNPD-CLLKLIRHDAEH 101
            :..||.:...|..|....:.| .||...|.|.:..:      |.:|.....| |..:::..|..|
  Fly    60 LEKKDRSKVYDACWQTTRRTE-YKCRSDPEFQMHAF------IDSRKSCLEDPCATEMLAIDLTH 117

  Fly   102 YKPSDK-QRKFQRTWPECPLLWLRPKDYCCPDQEVYQPMNRRIRPPQEP-------PLSAIEKHL 158
            |||||. :||:.|||.||.:...:.|.:|.|   |..||.||.|..::|       .|..:|.:|
  Fly   118 YKPSDMGKRKYPRTWFECVVKRRKRKAHCVP---VPPPMPRRKRKSKKPRCPEDLCVLGKLELNL 179

  Fly   159 F----QMSIFCKSVRAP-CCKVGRRPPKCTKPRRPSECC--KKFTPMPSFSEACRHLIPRFCGSE 216
            .    :.|..|...|.| ||...|.||||   |||...|  :..|..|||||..|...|.....|
  Fly   180 IKPCVKESSKCPRFRMPNCCVAARDPPKC---RRPFRRCGQRPKTKYPSFSECRRDPFPDPRPIE 241

  Fly   217 CAC-RGGSLCEMWNTY 231
            |.| ...::|:||..|
  Fly   242 CNCLLKPAICDMWRHY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
colaNP_724673.1 DM6 84..232 CDD:214775 59/165 (36%)
CG4691NP_609719.1 DM6 100..258 CDD:214775 59/164 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.