DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cola and CG33340

DIOPT Version :9

Sequence 1:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster


Alignment Length:198 Identity:64/198 - (32%)
Similarity:85/198 - (42%) Gaps:26/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KDGKWFCPVKYEPNKCYEKPSF---------AVEEYSQYLQEIYNRGKT----NPDCLLKLIRHD 98
            |.|...||.......| .||:.         .|:..|.:|....:...|    ||       |.|
  Fly    31 KKGPSRCPKVLTKFPC-GKPNLQAPPKKKRKMVKAQSMWLNPFCDPDDTACPFNP-------RFD 87

  Fly    99 AEHYKPSDK-QRKFQRTWPECPLLWLRPKDYCCPDQEVYQPMNRRIRPPQEPPLSAIEKHLFQMS 162
            ..:|..||| :||:.:||..||.:.::||..||..:....|:.|| :|..:|..:..:.......
  Fly    88 DIYYVESDKAKRKYWQTWVACPPIQIKPKKICCFAKAKPAPIKRR-KPSAKPSTACPQPCPDPSE 151

  Fly   163 IFCKSVRAPCCKVGRRPPKCTKPRRPSECCKKFTPMPSFSEACRHLIPRFCG-SECACRGGS-LC 225
            ..|..:...|.:.|||||.|.:.|.|..|.|..||.||||| ||.|.|.... .||.|.... ||
  Fly   152 DLCPRLARRCHRDGRRPPSCRRERGPLPCVKPRTPYPSFSE-CRRLKPDAPPLKECNCLAKPLLC 215

  Fly   226 EMW 228
            |:|
  Fly   216 EIW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
colaNP_724673.1 DM6 84..232 CDD:214775 54/152 (36%)
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 54/155 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FCF2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.