DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cola and hubl

DIOPT Version :9

Sequence 1:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster


Alignment Length:232 Identity:71/232 - (30%)
Similarity:93/232 - (40%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PRFSITSRWYNWGSYDASSGECCKMRDKDTTACKDGKWFCPVKYEPNKCYEKPSFAVEEYSQYLQ 78
            ||:|                 ||.........|.|          |:|   |..| |..:.:|..
  Fly    73 PRYS-----------------CCVSTGISANPCAD----------PSK---KTKF-VSMWKRYKD 106

  Fly    79 EIYNRGKTN--------PDCLLKLIRHDAEHYKPSDKQRKFQRTWPE-CPLLWLRPKDYCCPDQE 134
            :..||.:..        |.|  :..|.|..:|.||||.|:|||||.| ||.  :.||..||....
  Fly   107 DGSNRPEAMWHYPEECCPKC--EDTRFDVLYYTPSDKCREFQRTWWECCPK--MVPKRVCCWCDA 167

  Fly   135 VYQPMNRRIRP--PQEPPLSAIE----KHLFQMSIFCKSVRAPCCKVGRRPPKCTKPRRPSECCK 193
            :...:.||..|  |:...|:..|    |.|.:....|..:|.|||:..|.||.|.....||:|.|
  Fly   168 IPPEVLRRDLPICPRSACLAEHERKRYKCLNKRYKGCMRIRMPCCRTARIPPDCRAFPGPSDCEK 232

  Fly   194 KFTPMPSFSEACRH---LIPRFCGSECAC-RGGSLCE 226
            ...|.||:||..:.   :||. ...||.| :..|.||
  Fly   233 IKCPFPSYSECVQEDPAVIPT-RPPECECLKKASQCE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
colaNP_724673.1 DM6 84..232 CDD:214775 56/162 (35%)
hublNP_001286194.1 DUF1431 126..275 CDD:284625 55/148 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.