DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30357 and KLHL31

DIOPT Version :9

Sequence 1:NP_724707.1 Gene:CG30357 / 246563 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001003760.2 Gene:KLHL31 / 401265 HGNCID:21353 Length:634 Species:Homo sapiens


Alignment Length:501 Identity:100/501 - (19%)
Similarity:170/501 - (33%) Gaps:148/501 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KANK-DVEAVEELEEIQEMN--DELRDLFINTTAINCSSLSELKIQTDAFNTLKERTLFSLGYST 94
            |.|| |:..:..:.|...:|  :.|..|......::|.| |||   |||          |.|   
Human     9 KKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCIS-SEL---TDA----------SYG--- 56

  Fly    95 AGLLKKSKISKVLKGKVNLYQQ--IVSLVKQRTKTNSEITIGKTSHPVHLMVLQSFSRMFRD-MG 156
                     ..:|:|...:.|:  :..|| ..|||.        |..||..|:.|.|..|.: :.
Human    57 ---------PNLLEGLSKMRQENFLCDLV-IGTKTK--------SFDVHKSVMASCSEYFYNILK 103

  Fly   157 NDLSVALPE-KMITPRSFGLIYEWMIEDTPVLPRLGLLEVFHAAKFMEIPQLVRQCKYCLDHGFT 220
            .|.|:...: ..|:|.....:..:.......|....:..:..||.:::|..||:.|...|....:
Human   104 KDPSIQRVDLNDISPLGLATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMS 168

  Fly   221 EDSAAMLYFEAKILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEV 285
            .::...:...|:...|:.......:.:...||....|.:|::|..:.:..|:..|.:.:.:|:..
Human   169 VENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVA 233

  Fly   286 FMAAARWLSHHWPQREENVTDVVSSIRFGLIP--------------------------------- 317
            |..|.:||... .:|.:...|::|:||||.|.                                 
Human   234 FQIAMKWLEFD-QKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLL 297

  Fly   318 PWLLIRLQ------------------KPDVTSVGVGRIVAQPIVRQ------------------- 345
            |:....||                  :|.:|...:.|.:   :.|.                   
Human   298 PYHQNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDI---LYRDPENGWSKLTEMPAKSFNQC 359

  Fly   346 -AIHEGIAYTTTRMFYGKD----REAFKHYLHKACVKPPVQRTWIY----DRKCPYHHRMQCRNT 401
             |:.:|..|...    |:|    |...||.:...|...|...|||:    ::| ..|..:...| 
Human   360 VAVMDGFLYVAG----GEDQNDARNQAKHAVSNFCRYDPRFNTWIHLASMNQK-RTHFSLSVFN- 418

  Fly   402 VDLTYD----------AFLE-YLNYTQRQHRDYWKSLEPVDASNVC 436
             .|.|.          |.|| |:..|.:     |:...|::.:..|
Human   419 -GLVYAAGGRNAEGSLASLECYVPSTNQ-----WQPKTPLEVARCC 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 19/87 (22%)
BTB <139..211 CDD:295341 16/73 (22%)
BACK 226..323 CDD:285009 23/129 (18%)
DUF4734 337..427 CDD:292506 25/128 (20%)
KLHL31NP_001003760.2 BTB 63..164 CDD:279045 24/109 (22%)
PHA03098 73..601 CDD:222983 79/411 (19%)
BACK 172..273 CDD:285009 22/101 (22%)
Kelch 1 317..365 5/50 (10%)
KELCH repeat 356..405 CDD:276965 13/52 (25%)
Kelch 2 366..419 14/59 (24%)
Kelch 367..419 CDD:128874 14/58 (24%)
KELCH repeat 409..453 CDD:276965 11/50 (22%)
Kelch 420..466 CDD:128874 10/44 (23%)
Kelch 3 420..466 10/44 (23%)
Kelch_1 455..500 CDD:279660 1/4 (25%)
KELCH repeat 456..501 CDD:276965 1/3 (33%)
Kelch 4 468..513
Kelch_1 502..552 CDD:279660
KELCH repeat 503..551 CDD:276965
Kelch 5 515..565
KELCH repeat 555..602 CDD:276965
Kelch 6 567..614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.