DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30357 and CG10752

DIOPT Version :9

Sequence 1:NP_724707.1 Gene:CG30357 / 246563 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster


Alignment Length:410 Identity:90/410 - (21%)
Similarity:167/410 - (40%) Gaps:92/410 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NTLKERTLFSLGYSTAGLLKKSKISKVLKGKVNLYQQIVSLVKQRTKTNSEITIGKTSHPVHLMV 144
            |.|||...::       :|:.:...|    |:.|.:::...:::....::.|.:..|.:...:.|
  Fly    29 NRLKEHMKYN-------ILRNAVFYK----KIPLQKKLKLALERNIGPHAYIIVNDTIYKCQVFV 82

  Fly   145 LQSFSRMFRDMGNDLS----VALPEKMITPRSFGLIYEWMIEDTPVLPRLGLLEVFHAAKFME-I 204
            |:.:.::|.   |:|.    |..|...::...|.|.|.||..:...|||..::.:..|||.:: |
  Fly    83 LRIYCKLFT---NNLKRGDIVKFPRDAMSNECFELAYTWMTNNAIHLPRDKIINLLAAAKCLQCI 144

  Fly   205 PQLVRQCKYCLDH-GFTEDSAAMLYFEAKILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSM 268
            |.:.|..::..|: ...|..:...|.:||.:.:..:....:.||:|.||.||::.:|:::.:...
  Fly   145 PLIKRIFEFLNDYRTHCELFSFSCYLKAKDMGMTQVADMMVSRVTKSFLVLVSNGQFIKMDIDGA 209

  Fly   269 LLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRLQ------KP 327
            ..|::|..:.|..|:|:|.:|..||..::..|.:.:..|:|.:||.:||...:::..      :|
  Fly   210 CTLLRSRHLAVQNEIEIFYSALLWLISNYEMRIKYIPRVLSLVRFLMIPAVFILQWTSNLKDLRP 274

  Fly   328 DVTSVGVGRIVAQPIVRQAIHEGIAYTTTRMFYGKDREAFKHYLHKACVKP-------------- 378
            ::.:|                                  ..|:||.|.:..              
  Fly   275 ELANV----------------------------------LCHFLHNAMLSQFEYYTETFQSESII 305

  Fly   379 PVQRTWIYDRKCPYHHRMQCRNTVDLTYDAFLEYLNYTQ------------RQHRDYWKSLEPVD 431
            ...|.|..|.:|||..........||:.|.|..||...|            :.|.:|    |..|
  Fly   306 RGNRRWAQDPQCPYLSLFNANGDSDLSPDVFFRYLRQIQNSPKSFVARLIMKDHMEY----EIGD 366

  Fly   432 ASNVCFSCQAKKS--DLTKP 449
            |..|..|..::.|  ||.:|
  Fly   367 ALTVNESWTSENSAEDLKEP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 23/90 (26%)
BTB <139..211 CDD:295341 21/76 (28%)
BACK 226..323 CDD:285009 27/96 (28%)
DUF4734 337..427 CDD:292506 19/115 (17%)
CG10752NP_648614.1 BACK 172..264 CDD:197943 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.