DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30357 and CG8260

DIOPT Version :9

Sequence 1:NP_724707.1 Gene:CG30357 / 246563 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster


Alignment Length:416 Identity:88/416 - (21%)
Similarity:163/416 - (39%) Gaps:69/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LFINTTAINCSSLSE--------LKIQTDAFNTLKERTLFSLGYSTAGLLKKSKISKVLK--GKV 111
            ||:.....|.|.|..        :.::|.......|:|..:...|...|.:....|::::  .:|
  Fly    16 LFLTPNLCNLSKLINSQCPYVHFINVRTRERLCYLEQTFLNFANSIRTLKEDPTESEIVEIDHEV 80

  Fly   112 NLYQQIVSLVKQRTKTNSEITIGKTSHPVHLMVLQSFS-RMFRDMGNDLS-VALPEKMITPRSFG 174
            ...:.:|..::.....:..:|:.......|.::|..:| ||.:.:..|:. :......::|:.|.
  Fly    81 PPEEYLVPYIQNYECADIIVTVHDRVFLCHNIILSIYSRRMLKILQEDVDHIVFKSNDLSPKGFS 145

  Fly   175 LIYEWMIEDTPVLPRLGLLEVFHAAKFMEIPQLVRQCKYCLDH-GFTEDSAAMLYFEAK-ILKLE 237
            ..|.|||.....:....:.|:..||.|::||:|:..|...||. .|.|.||..|.||.: ...|.
  Fly   146 DAYLWMISSDGEVNPCDMGEILRAAYFLDIPELLEACWANLDRITFFEISAFRLLFELRGATNLW 210

  Fly   238 VIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVFMAAARWLSHHWPQREE 302
            .:..:...|:|...|.:.:::|||.|....:..:::|:.:.:|:|:|....:.         |..
  Fly   211 DVFDKLTGRISISILPVASTREFLCLSETQICYILKSNFLAINSEMEASSISI---------RRS 266

  Fly   303 NVTDVVSSIRFGLIPPWLLIRL-------------------QKPDVTSVGVGRIVAQPIVRQAIH 348
            :...|:|.|||..:||.:|.:.                   :.|||.:          ::|.::.
  Fly   267 STYRVLSQIRFSFLPPLMLKKFRSEELHKMPEFSDILKEFSKSPDVIT----------LLRDSVF 321

  Fly   349 EGIAYTTTRMFYGKDREAFKHYLHKACVKPPVQRTWIYDRKCPYHHRMQ--CRNTVDLTYDAFLE 411
            ......|.|    .:......::....|:....|.|:.|..|.||.::.  |.|...:|.:.:.|
  Fly   322 NSSLLLTVR----NNPSVLDTHVEFTEVELMEPRHWVQDHTCDYHRKVTQLCPNMRFITLNEYQE 382

  Fly   412 YLNYTQRQHRDYWKSLEPVDASNVCF 437
            ||           |.|......|.||
  Fly   383 YL-----------KRLSIGPEFNTCF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 22/87 (25%)
BTB <139..211 CDD:295341 19/73 (26%)
BACK 226..323 CDD:285009 24/97 (25%)
DUF4734 337..427 CDD:292506 17/91 (19%)
CG8260NP_573069.1 BTB 91..182 CDD:295341 20/90 (22%)
BTB 97..190 CDD:197585 23/92 (25%)
BACK 200..287 CDD:197943 23/95 (24%)
DUF4734 308..387 CDD:292506 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.