DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30357 and CG12692

DIOPT Version :9

Sequence 1:NP_724707.1 Gene:CG30357 / 246563 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster


Alignment Length:263 Identity:76/263 - (28%)
Similarity:122/263 - (46%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FRDMGNDLSVALPEKMITPRSFGLIYEWMIEDTPVLPRL---GLLEVFHAAKFMEIPQLVRQC-- 211
            ||: |.|| :|:        .|...|.||....|:.|.:   .|:.:.|.|..:|:|.|...|  
  Fly    96 FRE-GTDL-IAV--------GFRAAYTWMRLQEPLDPFMQPDKLMTLLHTAVQLEMPALKALCYE 150

  Fly   212 KYCLDHGFTEDSAAMLYFEA-KILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSD 275
            :.|.|. |.|::|..:|..| |..:||.:....|:|:...||.::...:|.|:||:.::.::|.|
  Fly   151 QLCTDR-FREETAFQVYLRALKYPQLEELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQD 214

  Fly   276 LIGVNTELEVFMAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRLQK-------PDVTSVG 333
            .:|||:|:||.:|..|||:......::....::..:|..|:|..:|.|..:       ||     
  Fly   215 SLGVNSEMEVLVAIIRWLNCQSKCIDQATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPD----- 274

  Fly   334 VGRIVAQPI---VRQAIH--EGI--AYTTTRMFY-GKDREAFKHYLHKACVKPPVQRTWIYDRKC 390
                  :|.   ||..||  |.|  |.|..:|.: ...|..|..:.....:...:.|.||||.:|
  Fly   275 ------EPFMNAVRGNIHIRERISCAITVVQMHHLHTSRREFLDFCRSKGLLVDMPREWIYDEQC 333

  Fly   391 PYH 393
            .||
  Fly   334 HYH 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 20/69 (29%)
BTB <139..211 CDD:295341 18/61 (30%)
BACK 226..323 CDD:285009 29/97 (30%)
DUF4734 337..427 CDD:292506 20/65 (31%)
CG12692NP_001284857.1 BACK 162..265 CDD:285009 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119992
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.