DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and QCR6

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_116691.3 Gene:QCR6 / 850593 SGDID:S000001929 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:80 Identity:25/80 - (31%)
Similarity:38/80 - (47%) Gaps:8/80 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKT--------TETCMEELFDFVA 71
            :::|:|:.|....|||..:......:|.:.|:||.:||..:.:.        .|.|:||.|....
Yeast    68 EEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQH 132

  Fly    72 ELDHCVAHSLFSKLK 86
            .||...|..||.|||
Yeast   133 YLDTATAPRLFDKLK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 20/69 (29%)
QCR6NP_116691.3 UCR_hinge 76..147 CDD:396756 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52039
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - O PTHR15336
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.