DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and UQCRH

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_005995.2 Gene:UQCRH / 7388 HGNCID:12590 Length:91 Species:Homo sapiens


Alignment Length:72 Identity:32/72 - (44%)
Similarity:47/72 - (65%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEELFDFVAELDHCVAH 79
            :::|:|||||...:||:|:..........:.:.|::||:.:|.|.|.|.||||||:...||||||
Human    20 EEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAH 84

  Fly    80 SLFSKLK 86
            .||:.||
Human    85 KLFNNLK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 26/61 (43%)
UQCRHNP_005995.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/9 (56%)
UCR_hinge 28..91 CDD:367034 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159187
Domainoid 1 1.000 64 1.000 Domainoid score I10110
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5277
Isobase 1 0.950 - 0 Normalized mean entropy S1584
OMA 1 1.010 - - QHG52039
OrthoDB 1 1.010 - - D1621720at2759
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - mtm8595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9909
SonicParanoid 1 1.000 - - X4498
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.850

Return to query results.
Submit another query.