DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and UQCR-11

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001104407.2 Gene:UQCR-11 / 5740185 FlyBaseID:FBgn0260008 Length:85 Species:Drosophila melanogaster


Alignment Length:86 Identity:67/86 - (77%)
Similarity:78/86 - (90%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEE 65
            |||.:...:|.::|||:| :||||||.|||||||||||.|||||||||||||||:|||||||:||
  Fly     1 MAFRNWFSLPAVRADDEE-DLVDPQAVLREKCQAKGHIESLYNKYQECNDRVNGRSKTTETCIEE 64

  Fly    66 LFDFVAELDHCVAHSLFSKLK 86
            |||:||||||||:||||:|||
  Fly    65 LFDYVAELDHCVSHSLFTKLK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 54/61 (89%)
UQCR-11NP_001104407.2 UCR_hinge 22..84 CDD:280480 54/61 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469264
Domainoid 1 1.000 43 1.000 Domainoid score I4736
eggNOG 1 0.900 - - E1_KOG4763
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2651
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52039
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm25422
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - P PTHR15336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4498
1110.800

Return to query results.
Submit another query.