DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and uqcrh

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001032185.1 Gene:uqcrh / 566723 ZFINID:ZDB-GENE-051030-93 Length:90 Species:Danio rerio


Alignment Length:72 Identity:33/72 - (45%)
Similarity:48/72 - (66%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEELFDFVAELDHCVAH 79
            :::|:|:|||...:|:||:...|.|....:.:.|..|||.:|:|||.|.||||||:...||||||
Zfish    19 EEEEEEMVDPLETVRQKCEETEHCAHARERLESCETRVNSRSQTTEDCTEELFDFLHARDHCVAH 83

  Fly    80 SLFSKLK 86
            .:|..:|
Zfish    84 KVFQSIK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 29/61 (48%)
uqcrhNP_001032185.1 UCR_hinge 27..86 CDD:280480 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595289
Domainoid 1 1.000 71 1.000 Domainoid score I9392
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5206
OMA 1 1.010 - - QHG52039
OrthoDB 1 1.010 - - D1621720at2759
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm25422
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - O PTHR15336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9909
SonicParanoid 1 1.000 - - X4498
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.