powered by:
Protein Alignment UQCR-11L and qcr6
DIOPT Version :9
Sequence 1: | NP_001260811.1 |
Gene: | UQCR-11L / 246560 |
FlyBaseID: | FBgn0050354 |
Length: | 86 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001342708.1 |
Gene: | qcr6 / 2540140 |
PomBaseID: | SPBC16C6.08c |
Length: | 214 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 65 |
Identity: | 18/65 - (27%) |
Similarity: | 32/65 - (49%) |
Gaps: | 7/65 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGK---SKTTETCMEELFDFVAELDHC 76
:::|:|:.||...:.::|........:.:.::||..||..| ...:|.|:||.| .|.||
pombe 140 EEEEEEITDPLEKMTQECMDAPDCKEVKHHFEECTARVTKKVEQGDKSEDCIEEFF----HLYHC 200
Fly 77 76
pombe 201 200
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4763 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102683 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR15336 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.860 |
|
Return to query results.
Submit another query.