DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and qcr6

DIOPT Version :10

Sequence 1:NP_724697.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001342708.1 Gene:qcr6 / 2540140 PomBaseID:SPBC16C6.08C Length:214 Species:Schizosaccharomyces pombe


Alignment Length:65 Identity:18/65 - (27%)
Similarity:32/65 - (49%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGK---SKTTETCMEELFDFVAELDHC 76
            :::|:|:.||...:.::|........:.:.::||..||..|   ...:|.|:||.|    .|.||
pombe   140 EEEEEEITDPLEKMTQECMDAPDCKEVKHHFEECTARVTKKVEQGDKSEDCIEEFF----HLYHC 200

  Fly    77  76
            pombe   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_724697.1 UCR_hinge 23..86 CDD:460531 16/57 (28%)
qcr6NP_001342708.1 UCR_hinge 148..214 CDD:460531 16/57 (28%)

Return to query results.
Submit another query.