DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and qcr6

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001342708.1 Gene:qcr6 / 2540140 PomBaseID:SPBC16C6.08c Length:214 Species:Schizosaccharomyces pombe


Alignment Length:65 Identity:18/65 - (27%)
Similarity:32/65 - (49%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGK---SKTTETCMEELFDFVAELDHC 76
            :::|:|:.||...:.::|........:.:.::||..||..|   ...:|.|:||.|    .|.||
pombe   140 EEEEEEITDPLEKMTQECMDAPDCKEVKHHFEECTARVTKKVEQGDKSEDCIEEFF----HLYHC 200

  Fly    77  76
            pombe   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 16/57 (28%)
qcr6NP_001342708.1 UCR_hinge 148..213 CDD:308119 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102683
Panther 1 1.100 - - O PTHR15336
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.860

Return to query results.
Submit another query.