powered by:
Protein Alignment UQCR-11L and uqcrh
DIOPT Version :9
Sequence 1: | NP_001260811.1 |
Gene: | UQCR-11L / 246560 |
FlyBaseID: | FBgn0050354 |
Length: | 86 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031756806.1 |
Gene: | uqcrh / 100492979 |
XenbaseID: | XB-GENE-963373 |
Length: | 91 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 32/72 - (44%) |
Similarity: | 42/72 - (58%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEELFDFVAELDHCVAH 79
:::|:|||||...:||.|:............:.|..|||.:|.|.|.|.||||||:...||||||
Frog 20 EEEEEELVDPLTTVREHCEQSEKCVKAREILELCETRVNSRSHTEEECTEELFDFLHARDHCVAH 84
Fly 80 SLFSKLK 86
.:|..||
Frog 85 KVFKNLK 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
61 |
1.000 |
Domainoid score |
I10281 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
71 |
1.000 |
Inparanoid score |
I5140 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1621720at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005545 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48302 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4498 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.060 |
|
Return to query results.
Submit another query.