DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and uqcrh

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_031756806.1 Gene:uqcrh / 100492979 XenbaseID:XB-GENE-963373 Length:91 Species:Xenopus tropicalis


Alignment Length:72 Identity:32/72 - (44%)
Similarity:42/72 - (58%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEELFDFVAELDHCVAH 79
            :::|:|||||...:||.|:............:.|..|||.:|.|.|.|.||||||:...||||||
 Frog    20 EEEEEELVDPLTTVREHCEQSEKCVKAREILELCETRVNSRSHTEEECTEELFDFLHARDHCVAH 84

  Fly    80 SLFSKLK 86
            .:|..||
 Frog    85 KVFKNLK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 26/61 (43%)
uqcrhXP_031756806.1 UCR_hinge 28..91 CDD:396756 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10281
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621720at2759
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm48302
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4498
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.