DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIG

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_004783.2 Gene:PPIG / 9360 HGNCID:14650 Length:754 Species:Homo sapiens


Alignment Length:193 Identity:37/193 - (19%)
Similarity:70/193 - (36%) Gaps:57/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLS 276
            |||.:||:.:.: :|.||.|.:|:::..|......  .|:|....                   .
Human     7 RPRCFFDIAINN-QPAGRVVFELFSDVCPKTCENF--RCLCTGEK-------------------G 49

  Fly   277 SDSLLHQPLEYDA----KVID--------------------HGA----SSYVLSFSKAYVTGF-- 311
            :.....:||.|.:    :|:.                    :|.    .|:.:..:|.::...  
Human    50 TGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMAN 114

  Fly   312 ----THHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGT-KNGKLSRGLLFTSCGLL 369
                |:...|.|:.||...::|..|.||:::.|.::...|::..| ...|....:...|||.|
Human   115 RGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 36/191 (19%)
PPIGNP_004783.2 cyclophilin 8..175 CDD:412213 33/188 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..754
PTZ00121 <392..752 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.