DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and CPR8

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:41/214 - (19%)
Similarity:77/214 - (35%) Gaps:69/214 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 YEAF------NIPLP------KSDA-ELRRLFRP------RIYFDLYLKD---ARPLGRFV-VQL 234
            |.||      .:|||      .||: :|::.:.|      .:...:...|   :...||.: :.|
Yeast     9 YVAFMFSCITALPLPVDNKRASSDSLDLKKKYAPDPPITHNVNIGIVFTDPESSEEAGRLITIDL 73

  Fly   235 YTEAAPLVVLQL------IKSCMCNQHSKFMVK---RLFPNLWLETDLMLSSD------------ 278
            |....|..|:..      :|..:.::||....:   ::.||..:|...:.||.            
Yeast    74 YGTMVPKTVMTFCQYVDSVKDRLASRHSYSPERDFDKILPNGAIEGSSVSSSSIEETEMLAPKLP 138

  Fly   279 ----SLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIVK 339
                ||:|......:.:.|.....:::..|:                   |.:.|..|.||::..
Yeast   139 EENHSLIHDRPGRVSMIKDDKGLKFIIETSE-------------------TPLEGESVVFGQVTA 184

  Fly   340 GSK-ICECIQSYGT-KNGK 356
            |.| :.:.:.:..| :|||
Yeast   185 GLKDLMDKLANVKTDENGK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 32/182 (18%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 30/158 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.