DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and CPR4

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:39/205 - (19%)
Similarity:72/205 - (35%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LPKSDAELRRLFRPR-----------IYFDLYLKDARPLGRFVVQLYTEAAPLVVLQL------I 247
            :...|.:|::.:.|.           .|||...|..:. .....:||....|..|...      :
Yeast    28 ITSKDVDLQKKYEPSPPATHRGIITIEYFDPVSKSMKE-ADLTFELYGTVVPKTVNNFAMLAHGV 91

  Fly   248 KSCM---------CNQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLE-YDAKVIDHGASSYVLS 302
            |:.:         ...:.|..:.:::||.:::..::.....    |.. |..|..|   .::.|.
Yeast    92 KAVIEGKDPNDIHTYSYRKTKINKVYPNKYIQGGVVAPDVG----PFTVYGPKFDD---ENFYLK 149

  Fly   303 FSK------AYVTGFTHHLSFAISFKP--LTVVNGSRVGFGRIVKG-SKICECIQ-----SYGTK 353
            ..:      ||....::...|.|:.|.  ...::|..|.||:|..| .::.:.||     .||..
Yeast   150 HDRPERLAMAYFGPDSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLMDAIQYTETDEYGKP 214

  Fly   354 NGKLSRGLLF 363
            ..:| |.|.|
Yeast   215 QHEL-RFLYF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 37/193 (19%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 29/159 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.