DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and ROC1

DIOPT Version :10

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:174 Identity:43/174 - (24%)
Similarity:76/174 - (43%) Gaps:23/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQ---------H---SKFMVKRLFP 265
            |::|||:.: |.:|.||.|::|||:..|.........|...:         |   |||  .|:.|
plant     4 PKVYFDMTI-DGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKF--HRVIP 65

  Fly   266 NLWLETDLMLSSDSLLHQPLEYDAKVIDHG-----ASSYVLSFSKAYVTGFTHHLSFAISFKPLT 325
            |...:.....:.:....:.: |.:|..|..     ....:||.:.|...  |:...|.|......
plant    66 NFMCQGGDFTAGNGTGGESI-YGSKFEDENFERKHTGPGILSMANAGAN--TNGSQFFICTVKTD 127

  Fly   326 VVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCGLL 369
            .::|..|.||::|:|..:.:.|:..|:.:||.::.::...||.|
plant   128 WLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 34/156 (22%)
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 40/170 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.