DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and nphs1

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001035777.1 Gene:nphs1 / 692352 ZFINID:ZDB-GENE-051102-1 Length:1242 Species:Danio rerio


Alignment Length:171 Identity:41/171 - (23%)
Similarity:62/171 - (36%) Gaps:29/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KAAKAKPKKI-LGGLLMVNHMKMW---HQHRERIK-GAISTVDAEA------------PNFQAAR 82
            |.....||:. .||:...:.:.:.   |..|:||. .|.|.|.:|.            |.|.|.:
Zfish   572 KGVDQAPKRAEFGGMSRTSKLSLTLEPHHWRKRITCQAFSNVLSEGVNNFYSLDVLFPPEFSAEQ 636

  Fly    83 ITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHGAINPFRYDTVHAVSSIPMALLTLEKLERD 147
            ...|..:.||..|...:..||..   ||:......|.......|..:..|.     .|||.:...
Zfish   637 PDEVQVIEDETATLPAKVSANPD---EITCEWIFQGEKLVKERDPRYTFSD-----WTLEIVNVS 693

  Fly   148 NRDFGRRILEV-NSEVDSGLSDKRMREGRSSTPVAPLELPP 187
            .||.|..|:|. |:|   |.:..::|.....:|...::..|
Zfish   694 RRDGGDYIIECSNAE---GSNRTKLRLDVQYSPTVRMKSDP 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 27/107 (25%)
cyclophilin 212..369 CDD:294131
nphs1NP_001035777.1 IG_like 33..126 CDD:214653
Ig 133..216 CDD:386229
Ig 261..313 CDD:386229
Ig 333..419 CDD:386229
ig 439..511 CDD:365836
IG_like 637..719 CDD:214653 23/92 (25%)
Ig_3 723..800 CDD:372822 2/9 (22%)
Ig_hNephrin_like 814..922 CDD:143250
FN3 921..1012 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.