DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and Ppil6

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_017457315.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:270 Identity:57/270 - (21%)
Similarity:105/270 - (38%) Gaps:65/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 ANIQLLVEISRTMRTHGAINPFRY-DTVHAVSSIPMALLTLEK-LERDNRDFGRRILEVNSEVDS 164
            ::.|:...|:.|::   |..|.|: |.|    .||:.....:: ||...|:........:|.|..
  Rat    37 SSFQMSKTIAETLK---ANYPSRFEDPV----IIPLQEFAWDRYLEEKKRELKGETWVYSSYVIC 94

  Fly   165 GLSDKRMREGRSSTPVAP-----LELPPQAMAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDA 224
            .::|:.:.........|.     :::.|.|:  |||  :.|..:...|:......::.|:.: |.
  Rat    95 FINDQLLGNALDLKKWAQKVWDVVDIRPSAL--YEA--LTLDYATKFLKDTKHDFVFLDISI-DL 154

  Fly   225 RPLGRFVVQLYTEAAPLVVLQLIKSC-----MCNQHSKFMVKRLFPNLWLETDLMLS-SDSLLHQ 283
            .|:||.:.:||.:|.|       ::|     :|...|.|.          |..:.|. .||:.|:
  Rat   155 APIGRLIFELYCDACP-------RTCTNFQVLCTGTSGFS----------ERGIKLHYKDSIFHR 202

  Fly   284 PLE----YDAKVI----DHGASSYVLSF---------SKAYVTGFT---HHLS---FAISFKPLT 325
            .::    ....::    |.|.|.|..:|         :|..|.|..   ||.:   |.|:.:...
  Rat   203 VVKNGWVQGGDIVEGRGDDGESIYGPTFEDENFSVPHNKRGVLGMVNKGHHTNGSQFYITLQATP 267

  Fly   326 VVNGSRVGFG 335
            .::...|.||
  Rat   268 YLDKKYVAFG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 13/54 (24%)
cyclophilin 212..369 CDD:294131 33/153 (22%)
Ppil6XP_017457315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.