DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and Ppil2

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_006522510.1 Gene:Ppil2 / 66053 MGIID:2447857 Length:564 Species:Mus musculus


Alignment Length:312 Identity:66/312 - (21%)
Similarity:111/312 - (35%) Gaps:62/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RIKGAISTVDA-EAPNFQAARITGVNNLRD--EAQTFMKR-----------TKANIQLLVEISRT 113
            |..|.:.|.:| |..|.:|      .||||  ..:.|.::           .|.|:.....:...
Mouse   120 RTTGNVYTYEAVEQLNIKA------KNLRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFFHVKNN 178

  Fly   114 MRTHGAINPFRYDTVHAVSSIPMALL------TLEKLERDNRDF-GRRILEV------NSEVDSG 165
            ||   .|:|   |...|... |...|      |.|.|:...::| |..||..      ..:||. 
Mouse   179 MR---IIDP---DEEKAKQD-PSYYLKNTNSETRETLQELYKEFKGDEILAATMRPPEKKKVDQ- 235

  Fly   166 LSDKRMREGRSSTPVAPLELPPQAMAKYEAFNIPLPKSDAELRR--LFRPRIYFDLYLKDARPLG 228
            |:......|:.|.......:.|:  ..:||..|     |.::.|  ..:.:.|..|:...    |
Mouse   236 LNAAHYSTGKVSASFTSTAMVPE--TTHEAAVI-----DEDVLRYQFVKKKGYVRLHTNK----G 289

  Fly   229 RFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLE----TDLMLSSDSLLHQPLEYDA 289
            ...::|:.:..|......||.|....:...:..|...|..::    |......:|...:|.:.:.
Mouse   290 DLNLELHCDLTPKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGESFWGKPFKDEF 354

  Fly   290 KV-IDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIVKG 340
            :. :.|.... |||.:.:...  |:...|.|:|:....::.....|||:|.|
Mouse   355 RPNLSHTGRG-VLSMANSGPN--TNKSQFFITFRSCAYLDKKHTIFGRVVGG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 27/112 (24%)
cyclophilin 212..369 CDD:294131 26/134 (19%)
Ppil2XP_006522510.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418 12/44 (27%)
U-box domain, a modified RING finger 103..146 CDD:319361 11/31 (35%)
cyclophilin_RING 281..440 CDD:238904 26/130 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.