DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and Nphs1

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_072150.1 Gene:Nphs1 / 64563 RGDID:620460 Length:1252 Species:Rattus norvegicus


Alignment Length:175 Identity:43/175 - (24%)
Similarity:64/175 - (36%) Gaps:57/175 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WHQ---HRERIKGAISTVDAEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHG 118
            :||   |...:  .|:.|.| |.::...:.|..|.|..:        ..||| ||.|||.....|
  Rat   908 YHQGVVHSSLL--TIANVSA-AQDYALFKCTATNALGSD--------HTNIQ-LVSISRPDPPLG 960

  Fly   119 ----AINP--------------------FRYDTVHAVSSIPMALL-------TLEKLERDNRDFG 152
                :|:|                    .||:.:.....:.:.:|       ||..|:...| :.
  Rat   961 LKVVSISPHSVGLEWKPGFDGGLPQRFQIRYEALETPGFLHVDVLPTQATTFTLTGLKPSTR-YR 1024

  Fly   153 RRILEVNSEVDSGLSDKRMR-----EGRSSTP-----VAPLELPP 187
            ..:|..|:..||||:||.::     .|....|     ..|.||||
  Rat  1025 IWLLASNALGDSGLTDKGIQVSVTTPGPDQAPEDTDHQLPTELPP 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 26/125 (21%)
cyclophilin 212..369 CDD:294131
Nphs1NP_072150.1 Ig 52..128 CDD:299845
IG_like 52..127 CDD:214653
C2-set_2 155..242 CDD:285423
Ig_3 256..335 CDD:290638
IG_like 268..350 CDD:214653
C2-set_2 358..440 CDD:285423
I-set 460..555 CDD:254352
Ig 472..555 CDD:299845
Ig 563..646 CDD:299845
IG_like 670..750 CDD:214653
Ig 676..750 CDD:299845
Ig_3 753..834 CDD:290638
IG_like 762..848 CDD:214653
Ig 848..956 CDD:299845 18/59 (31%)
IG_like 859..949 CDD:214653 13/52 (25%)
FN3 955..1049 CDD:238020 18/94 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1043..1067 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1113..1144
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.