DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and ppil6

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001018433.1 Gene:ppil6 / 553623 ZFINID:ZDB-GENE-050522-70 Length:293 Species:Danio rerio


Alignment Length:212 Identity:41/212 - (19%)
Similarity:84/212 - (39%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PQA--MAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKS 249
            |||  ||..|.|.|      :.||......:|.|:. .....:||.:.:|:::..|       |:
Zfish   101 PQALYMALAEEFYI------SNLRSTGHIFVYMDIE-NGGEAVGRLLFELFSDVCP-------KT 151

  Fly   250 C-----MCN------------QHSKFMVKRLFPNLWLE-----TDLMLSSDSLLHQPLEYDAKVI 292
            |     :|.            .:...:..|:.||.|::     .:...:....::.|...|    
Zfish   152 CRNFKALCTGEAGLSKSNLELSYKGSVFHRVVPNGWIQGGDISPEKKGTGGESIYGPTFED---- 212

  Fly   293 DHGASSYVLSFSKAYVTGFTHH------LSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYG 351
                .::|:|.:|..:.|..:.      ..|.|:.:|.|.::...|.||::.:|:.:.:.:::..
Zfish   213 ----ENFVISHNKRGILGMANQGAHSNGSQFYITLQPATWMDQKYVAFGQLAEGTDVLKRLEAVP 273

  Fly   352 TKNGKLSRGLLFTSCGL 368
            |.|.:..:.....:||:
Zfish   274 TYNERPKQDCKIVACGI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 31/185 (17%)
ppil6NP_001018433.1 cyclophilin 125..289 CDD:294131 29/179 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.