DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and ppie

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001017678.1 Gene:ppie / 550373 ZFINID:ZDB-GENE-050417-167 Length:302 Species:Danio rerio


Alignment Length:367 Identity:71/367 - (19%)
Similarity:128/367 - (34%) Gaps:107/367 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKPKKIL--GGLLMVNHMKMWH---------------------QHRERIKGAISTVDAEAPNFQA 80
            |..|::|  |||......|:.|                     :||     ..:.::.|.....|
Zfish     2 AASKRVLYVGGLAEEVDEKVLHAAFIPFGDITDIQIPLDYETEKHR-----GFAFIEFELAEDSA 61

  Fly    81 ARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMR-THGAINPFRYDTVHAVSSIPMALLTLEKL 144
            |.|..:|    |::.|.:..:.|      |::.|| ..|:..|...|                  
Zfish    62 AAIDNMN----ESELFGRTIRVN------IAKPMRIKEGSSRPVWSD------------------ 98

  Fly   145 ERDN--RDFGRRILEVNSEVDSGL--SDKRMREGRSSTPVAPLELPPQAMAKYEAFNIPLPKSDA 205
              |:  :.|..:..|.:.|.:|..  :....:||.          ||   ||....|        
Zfish    99 --DDWLKKFSGKKAEESEEAESAAESASTETQEGE----------PP---AKKGRTN-------- 140

  Fly   206 ELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVK-----RLFP 265
                   |::|.|:.:.: :|.||....|..:..|:.....  .|:|.....|..|     |:.|
Zfish   141 -------PQVYMDIKIGN-KPAGRLRFLLRADVVPMTAENF--RCLCTHEKGFGFKGSSFHRIIP 195

  Fly   266 NLWLETDLMLSSD-----SLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLT 325
            ....:.....:.:     |:..:..|.:..|:.|   ::....|.|.....|:...|.|:.....
Zfish   196 QFMCQGGDFTNHNGTGGKSIYGRKFEDENFVLKH---THAGQLSMANSGPNTNGSQFFITVDKTD 257

  Fly   326 VVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCG 367
            .::|..|.||.:.:|..:...:::.|||:||..:.::.::||
Zfish   258 WLDGKHVVFGELTEGMDVLRAMEAQGTKDGKPKQKVIISNCG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 18/97 (19%)
cyclophilin 212..369 CDD:294131 35/166 (21%)
ppieNP_001017678.1 RRM_PPIE 8..80 CDD:240793 15/80 (19%)
cyclophilin_ABH_like 141..299 CDD:238907 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.