DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIC

DIOPT Version :10

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_000934.1 Gene:PPIC / 5480 HGNCID:9256 Length:212 Species:Homo sapiens


Alignment Length:176 Identity:36/176 - (20%)
Similarity:68/176 - (38%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCN-----QHSKFMVKRLFPNLWLETDL 273
            :::||:.:.| :.:||.|:.|:.:..|..|...:......     :.|||  .|:..:..::...
Human    39 KVFFDVRIGD-KDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKF--HRVIKDFMIQGGD 100

  Fly   274 MLSSDSLLHQPLEYDAKVIDHGASSYVLSFS------KAYVTGF---------THHLSFAISFKP 323
            :.:.|.             ..|.|.|..:|.      |.|..|:         |:...|.|:...
Human   101 ITTGDG-------------TGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTK 152

  Fly   324 LTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCGLL 369
            .|.::|..|.||:::.|..:...|:...|...  .|.|  |:|.::
Human   153 PTWLDGKHVVFGKVIDGMTVVHSIELQATDGH--DRPL--TNCSII 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 32/159 (20%)
PPICNP_000934.1 cyclophilin 39..197 CDD:469651 36/176 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.