DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIL1

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:108 Identity:26/108 - (24%)
Similarity:40/108 - (37%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 PNLWLETDLMLSSDSLL--HQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVV 327
            ||::|||.:.:....|.  |.|             ....:|::....|:.:...|....|...:.
Human    12 PNVYLETSMGIIVLELYWKHAP-------------KTCKNFAELARRGYYNGTKFHRIIKDFMIQ 63

  Fly   328 NGSRVGFGRIVKGSKICECIQSYGTK-NGKLSRGLLFTSCGLL 369
            .|...|.||  .|:.|      ||.: ..:|...|.||..|:|
Human    64 GGDPTGTGR--GGASI------YGKQFEDELHPDLKFTGAGIL 98

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 25/106 (24%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 24/105 (23%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 1/10 (10%)