DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and NPHS1

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_004637.1 Gene:NPHS1 / 4868 HGNCID:7908 Length:1241 Species:Homo sapiens


Alignment Length:143 Identity:33/143 - (23%)
Similarity:53/143 - (37%) Gaps:43/143 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HRERIKGAISTVD--AEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHG---- 118
            |:..:..::.|:.  :.|.::.....|..|.|..:        :.||| ||.|||.....|    
Human   895 HQGGVHSSLLTIANVSAAQDYALFTCTATNALGSD--------QTNIQ-LVSISRPDPPSGLKVV 950

  Fly   119 AINP--------------------FRYDTV-----HAVSSIP--MALLTLEKLERDNRDFGRRIL 156
            ::.|                    .||:.:     |.|..:|  ....||..|:...| :...:|
Human   951 SLTPHSVGLEWKPGFDGGLPQRFCIRYEALGTPGFHYVDVVPPQATTFTLTGLQPSTR-YRVWLL 1014

  Fly   157 EVNSEVDSGLSDK 169
            ..|:..||||:||
Human  1015 ASNALGDSGLADK 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 25/127 (20%)
cyclophilin 212..369 CDD:294131
NPHS1NP_004637.1 V-set 38..119 CDD:284989
IG_like 38..113 CDD:214653
C2-set_2 141..228 CDD:285423
Ig 240..321 CDD:299845
IG_like 254..336 CDD:214653
Ig 345..424 CDD:299845
Ig 445..530 CDD:299845
I-set 446..541 CDD:254352
Ig 549..632 CDD:299845
IG_like 558..642 CDD:214653
I-set 646..736 CDD:254352
Ig 662..736 CDD:299845
Ig_3 739..820 CDD:290638
IG_like 748..821 CDD:214653
Ig8_hNephrin_like 834..942 CDD:143250 14/55 (25%)
IG_like 845..935 CDD:214653 9/48 (19%)
fn3 942..1023 CDD:278470 14/81 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1025..1057 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1099..1137
Binds to NPHS2 1160..1241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.