DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and CG5071

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster


Alignment Length:188 Identity:36/188 - (19%)
Similarity:60/188 - (31%) Gaps:76/188 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RELAQLTEQERLTAQLKVKERKKAAKAKPKKILGGLLMVNHMKM-------WHQHRERIKGAIST 70
            |||.:...:    .||.||..               ::.:|..|       ||:..||       
  Fly   210 RELCEACYR----VQLHVKRE---------------MLEHHSSMVAASMIGWHRLAER------- 248

  Fly    71 VDAEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHGAINPFRYDTVHAVSSIP 135
             |..    :..|:||...|:..|....:|.:...||                   |.||....:.
  Fly   249 -DLH----RVGRLTGAKMLQVLAHLATQRQRYERQL-------------------DQVHFQCRMQ 289

  Fly   136 MALLTLEKLERDNRDFGRRILE---VNSEVDSGLSDKRMREGRSSTPVAPLELPPQAM 190
            .|:          ::.|.::|:   :|:.:      .|:|..|....:.....||||:
  Fly   290 AAI----------QENGMQVLDFETLNNRI------ARLRSHRRPGAIPANVGPPQAL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 16/94 (17%)
cyclophilin 212..369 CDD:294131
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.