DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and side-VIII

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster


Alignment Length:251 Identity:53/251 - (21%)
Similarity:85/251 - (33%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 DTVHAVSSIPMALLTLEKLERDNRDF---------GR-----RILEVNSEVDSGLSDKRMREGRS 176
            :|.|..||:.......:.:.:|..|.         ||     .:.|.|:.:.||..|..|   .:
  Fly   849 ETCHVTSSLDSIDKNPDIIPQDGHDLDDEWTTKGHGRTYATAAMAEQNAVITSGTYDHLM---PT 910

  Fly   177 STPVAPLELPPQAMAKYEAFN--IPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQ----LY 235
            ...|.....||....:|..:|  ||:.|..|              |....:.|.:...|    .|
  Fly   911 YAVVDKKTAPPPGHGQYIQYNTLIPVSKMGA--------------YANQQQQLQQQPQQKTELSY 961

  Fly   236 TE-AAPLV-----VLQLIKSC---MCNQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLEYDAKV 291
            :| :||||     |.::...|   :.....:..:||..||::.:.::|:..:.|.      |.:.
  Fly   962 SELSAPLVSGPVGVQRMAPYCSATLGRPGRQAELKRAEPNIYSQVNVMMDDEILA------DLQA 1020

  Fly   292 IDHGASSYVL--------SFSKAYVTGF------THHLSFAISFKPLTVVNGSRVG 333
            ......|||.        .....||.|:      .||.....|..|:...|.:..|
  Fly  1021 ATASGRSYVAGAVVDNVGGAPNLYVQGYATRIDLAHHPMPMYSTSPMFGTNSTITG 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 8/42 (19%)
cyclophilin 212..369 CDD:294131 30/149 (20%)
side-VIIINP_001097382.2 Ig 55..166 CDD:299845
IG_like 60..166 CDD:214653
Ig 182..266 CDD:299845
Ig 296..373 CDD:299845
IG_like 389..464 CDD:214653
IGc2 394..459 CDD:197706
Ig_3 490..554 CDD:290638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.