DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and ppiab

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001315353.1 Gene:ppiab / 335519 ZFINID:ZDB-GENE-030131-7459 Length:164 Species:Danio rerio


Alignment Length:167 Identity:37/167 - (22%)
Similarity:68/167 - (40%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVK-----RLFPNLWLETD 272
            |:::||:.: |.:..||.|::|..:..|......  ..:|.....|..|     |:.|....:..
Zfish     4 PKVFFDITI-DGKEAGRIVMELRADVVPKTAENF--RALCTGEKGFGYKGSGFHRVIPQFMCQGG 65

  Fly   273 LMLSSD-----SLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRV 332
            ...:.:     |:.....|.:...:.||...   :.|.|.....|:...|.|.......::|..|
Zfish    66 DFTNHNGTGGKSIYGNKFEDENFTLKHGGKG---TLSMANAGPNTNGSQFFICTADTNWLDGKHV 127

  Fly   333 GFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCGLL 369
            .||::|.|..:.:.|:..|:.:||.|..::..:||.|
Zfish   128 VFGKVVDGLDVVDAIEKKGSSSGKCSAKVVIANCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 36/165 (22%)
ppiabNP_001315353.1 cyclophilin_ABH_like 4..162 CDD:238907 34/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.