DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and ninaA

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:167 Identity:32/167 - (19%)
Similarity:63/167 - (37%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLSSD 278
            |||.|: ..:.:|:||....|:.:.||..|......|:...:....|...|..: ::..|:...|
  Fly    28 RIYMDV-KHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRV-VDRFLVQGGD 90

  Fly   279 SLL------------HQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSR 331
            .:.            :.|.|..|..::|....|:   ..|.....|:...|.::......::|..
  Fly    91 IVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYL---GMANRGPDTNGCQFYVTTVGAKWLDGKH 152

  Fly   332 VGFGRIVKGSKICECIQSYGTKNGKLS-RGLLFTSCG 367
            ..||::::|......|:...|...... ..::.::||
  Fly   153 TVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 32/167 (19%)
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 30/165 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.