DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and CG15767

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster


Alignment Length:335 Identity:125/335 - (37%)
Similarity:190/335 - (56%) Gaps:29/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ERIKGAISTVDAEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHGAINPFRYD 126
            :|:..|.|.|....|.......:|.:.|.::|:.|::||.||::||:.:|:..||.|.|:.....
  Fly    38 QRLSRATSLVHKRPPLMNVKTQSGFDVLHEDARIFLERTNANVRLLLNLSKIKRTKGTIDFVEGP 102

  Fly   127 TVHAVSSIPMALLTLEKLERDNRDFGRRILEVNSEVDSGLSDKRMREGRSSTPVAP------LEL 185
            .:...|::|..|..|::::|.|...|.|::.::.....|  |:|.|||.....::.      |..
  Fly   103 PLIPQSALPQMLQRLDRVQRHNLWLGLRLMRIHERKREG--DQRKREGDQQKRISEQSQSSNLRC 165

  Fly   186 PP-----------QAMAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAA 239
            |.           :...||..:::.:|....||.||.||||.....|.|.||||:.|||||||||
  Fly   166 PSTITNRSTLGENEVFNKYIGWDLDMPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAA 230

  Fly   240 PLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLSSDSLL--------HQPLEYDAKVIDHGA 296
            ||||||.:::|:..:..:|.|:|:||.||:|..|:.|..:.|        ..|:|:|.:|:.|..
  Fly   231 PLVVLQFVRTCLGQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHAR 295

  Fly   297 SSYVLSFSKAY-VTGFT-HHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSR 359
            .::|||.:|.| |.||. ..::|:||||||.|..|.||||||:::|.|:.|.::::||||||:||
  Fly   296 YAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISR 360

  Fly   360 GLLFTSCGLL 369
            .||.|.|.||
  Fly   361 PLLITHCELL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 27/92 (29%)
cyclophilin 212..369 CDD:294131 80/166 (48%)
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 80/166 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27333
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.