DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and Ppie

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:371 Identity:75/371 - (20%)
Similarity:126/371 - (33%) Gaps:116/371 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKPKKIL--GGLLMVNHMKMWH---------------------QHRERIKGAISTVDAEAPNFQA 80
            |..|::|  |||......|:.|                     :||     ..:.|:.|.....|
  Rat     2 ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHR-----GFAFVEFELAEDAA 61

  Fly    81 ARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMR-THGAINPFRYDTVHAVSSIPMALLTLEKL 144
            |.|..:|    |::.|.:..:.|      :::.|| ..|:..|...|                  
  Rat    62 AAIDNMN----ESELFGRTIRVN------LAKPMRIKEGSSRPVWSD------------------ 98

  Fly   145 ERDN--RDFGRRILEVNSEVDSGLSDKRMREGRSSTPVAPLELPPQAMAKYEAFNIPLPKSD-AE 206
              |:  :.|..:.||.|.|          .||..         ||:|.|         |:.: |.
  Rat    99 --DDWLKKFSGKTLEENKE----------EEGPE---------PPKAEA---------PEGEPAA 133

  Fly   207 LRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVK-----RLFPN 266
            .:....|::|.|:.:.: :|.||..:.|.::..|:.....  .|:|.....|..|     |:.|.
  Rat   134 KKARSNPQVYMDIKIGN-KPAGRIQMLLRSDVVPMTAENF--RCLCTHEKGFGFKGSSFHRIIPQ 195

  Fly   267 LWLETDLMLSSDSLLHQPLE----YDAKVIDHGASSYVLS------FSKAYVTGFTHHLSFAISF 321
            ...:     ..|...|....    |..|..|   .:::|.      .|.|.....|:...|.::.
  Rat   196 FMCQ-----GGDFTNHNGTGGKSIYGKKFDD---ENFILKHTGPGLLSMANSGPNTNGSQFFLTC 252

  Fly   322 KPLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCG 367
            .....::|..|.||.|..|..:...|::.|:|:||..:.::...||
  Rat   253 DKTDWLDGKHVVFGEITDGLDVLRQIEAQGSKDGKPKQKVIIADCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 18/97 (19%)
cyclophilin 212..369 CDD:294131 37/171 (22%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783 17/88 (19%)
cyclophilin_ABH_like 140..298 CDD:238907 35/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.