DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and Ppic

DIOPT Version :10

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:166 Identity:31/166 - (18%)
Similarity:61/166 - (36%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLM 274
            |...:::||:.:.| :.:||.|:.|:.:..|..|...:  .:......:..|             
  Rat    35 LVTDKVFFDVRIGD-KDVGRIVIGLFGKVVPRTVENFV--TLATGEKGYGYK------------- 83

  Fly   275 LSSDSLLHQPL--------EYDAKVIDHGASSYVLSFS------KAYVTGF---------THHLS 316
               .|:.|:.:        ::.|:....|.|.|..:|.      |.|..|:         |:...
  Rat    84 ---GSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQ 145

  Fly   317 FAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGT 352
            |.|:......::|..|.||:::.|..:...|:...|
  Rat   146 FFITLTKPAWLDGKHVVFGKVLDGMTVVHSIELQAT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 27/149 (18%)
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 30/163 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.