DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIL6

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001104768.2 Gene:PPIL6 / 285755 HGNCID:21557 Length:337 Species:Homo sapiens


Alignment Length:349 Identity:58/349 - (16%)
Similarity:121/349 - (34%) Gaps:133/349 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHGAINPFRYDTVHAVSSIPMALLT 140
            ||||.|: :...||::.                            :|.:::.       |: |:.
Human    35 PNFQIAK-SAAENLKNN----------------------------HPSKFED-------PI-LVP 62

  Fly   141 LEK------LERDNRDFGRRILEVNSEVDSGLSDKRMREGRSSTPVAP-----LELPPQAMAKYE 194
            |::      |:...|:......|.:|.|.|.::.:.:.:.......|.     :::.|.|:  |:
Human    63 LQEFAWHQYLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKPSAL--YD 125

  Fly   195 AFNIPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSC-----MCNQ 254
            |.....  |...||......::.|:.: |:.|:||.:.:||.:..|       |:|     :|..
Human   126 ALTEDF--SAKFLRDTKHDFVFLDICI-DSSPIGRLIFELYCDVCP-------KTCKNFQVLCTG 180

  Fly   255 HSKF------------MVKRLFPNLWLE-TDLMLSSDSLLHQPLEYDAKVIDHGASSYVLSFSKA 306
            .:.|            :..|:..|.|:: .|::....              |:|.|.|..:|.:.
Human   181 KAGFSQRGIRLHYKNSIFHRIVQNGWIQGGDIVYGKG--------------DNGESIYGPTFEEL 231

  Fly   307 Y-----------------------------------VTGFTH---HLS---FAISFKPLTVVNGS 330
            |                                   |.|..:   |.:   |.|:.:....::..
Human   232 YGSLKRSVKRQKESRGVGKIEKYRDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRK 296

  Fly   331 RVGFGRIVKGSKICECIQSYGTKN 354
            .|.||::::|:::.:.::...|:|
Human   297 FVAFGQLIEGTEVLKQLELVPTQN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 13/84 (15%)
cyclophilin 212..369 CDD:294131 33/202 (16%)
PPIL6NP_001104768.2 cyclophilin 144..333 CDD:412213 33/199 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.