DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and CG32236

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:394 Identity:107/394 - (27%)
Similarity:179/394 - (45%) Gaps:56/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TPSQRELAQLTEQERLTAQL---------KVKERKKAAKAKPKKIL--------------GGLLM 50
            ||:.|.: || ..:::..:|         |:.:.|....|:.:||:              ..::.
  Fly    15 TPTSRSI-QL-RAKKVAKELVMQNKDVRDKILKNKVLTYAQFRKIMKSAGNVTDLNPITYKSMIE 77

  Fly    51 VNHMKMWHQHRERIKGAISTVDAEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMR 115
            :...::.|:..:.||.|..::...|.....:::.|..|.:.|  .|.|    |::||..|::|.|
  Fly    78 IRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFNQKQE--IFRK----NMELLGRINKTNR 136

  Fly   116 THGAINPFRYDTVHAVSSIPMALLTLEKLERDNRDFGRRILEVNSEVDSGLSDKRMREGRSSTPV 180
            ..|.::.|........|:........::|.::||..|.|:.:|.|:||            |..|.
  Fly   137 LKGGVDSFNRHFPALQSNRNKIRELADRLSQENRQLGCRLSQVKSKVD------------SHNPW 189

  Fly   181 APLELPPQAMAKYEAFNIPLP--------KSDAELRRLFRPRIYFDLYLKDARP-LGRFVVQLYT 236
            .|...|.:..|..|..:..||        |..|::  |.||.||||:.:::... :||.::||||
  Fly   190 VPPVKPLEQKASDETVSTFLPYMPSPRLGKRSAQI--LLRPIIYFDMAVRENNQFMGRLLLQLYT 252

  Fly   237 EAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLEYDAKVIDHGASSYVL 301
            |.:|.|||:.::....|........|:|.|||:|.:|:.:....||.........:|....:.||
  Fly   253 ELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELVPAVHDSLHNHHSVKYSFLDPSKITGVL 317

  Fly   302 SFSKAYVTGFTHH-LSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTS 365
            |:...|...|... ||:.||||. :|:...||.|||:..|.::.:....:||||||..:.::.|.
  Fly   318 SYPWDYRRHFPQGLLSYTISFKQ-SVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTR 381

  Fly   366 CGLL 369
            ||||
  Fly   382 CGLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 22/94 (23%)
cyclophilin 212..369 CDD:294131 55/158 (35%)
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 24/97 (25%)
cyclophilin 227..385 CDD:294131 55/158 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.