DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIL2

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:304 Identity:55/304 - (18%)
Similarity:110/304 - (36%) Gaps:42/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AISTVDAEAPNFQAARITGVNNLRDEAQTFMKRT---KANIQLLVEISRTMRTHGAINPFRYDTV 128
            |:..::.:|.||:.. :|.....|.:..|....|   |.|:.....:...|:   .|:|   |..
Human   130 AVEQLNIKAKNFRDL-LTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMK---IIDP---DEE 187

  Fly   129 HAVSSIPMALL------TLEKLERDNRDF-GRRILEV------NSEVDSGLSDKRMREGRSSTPV 180
            .|... |...|      |.|.|:...::| |..||..      ..:||. |:......|:.|...
Human   188 KAKQD-PSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDK-LNAAHYSTGKVSASF 250

  Fly   181 APLELPPQAMAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQ 245
            ....:.|:...:..|.:     .|....:..:.:.|..|:...    |...::|:.:..|.....
Human   251 TSTAMVPETTHEAAAID-----EDVLRYQFVKKKGYVRLHTNK----GDLNLELHCDLTPKTCEN 306

  Fly   246 LIKSCMCNQHSKFMVKRLFPNLWLE----TDLMLSSDSLLHQPLEYDAKV-IDHGASSYVLSFSK 305
            .|:.|..:.:...:..|...|..::    |......:|...:|.:.:.:. :.|.... :||.:.
Human   307 FIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRG-ILSMAN 370

  Fly   306 AYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQS 349
            :...  ::...|.|:|:....::.....|||:|.|..:...:::
Human   371 SGPN--SNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMEN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 22/97 (23%)
cyclophilin 212..369 CDD:294131 23/143 (16%)
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418 7/29 (24%)
U-box domain, a modified RING finger 103..146 CDD:319361 4/16 (25%)
cyclophilin_RING 281..440 CDD:238904 23/139 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.