DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and cyn-4

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:216 Identity:42/216 - (19%)
Similarity:73/216 - (33%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 EVNSEVDSGLSDKRMREGRSSTPVAPLELPPQAMAKYEAFNIPLPKSDAELRRLFRPRIYFDLYL 221
            |:|:   :..|..::..|.:||.:||:.....|:...:.......|.:|.:|.:..         
 Worm   235 EINA---AHYSQGKVAAGFTSTVMAPVTSNKAAVLDNDTVRYSRVKKNAFVRLVTN--------- 287

  Fly   222 KDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLE 286
                 .|...::|:....|......|..|....::.....||..|..|:..              
 Worm   288 -----FGPLNLELFAPKVPKACENFITHCSNGYYNNTKFHRLIKNFMLQGG-------------- 333

  Fly   287 YDAKVIDHGASS-YVLSFSKAYVTGFTHHL----------------SFAISFKPLTVVNGSRVGF 334
             |.....||..| :...||..:::||:|..                .|.|:|:|...::.....|
 Worm   334 -DPTGTGHGGESIWDKPFSDEFISGFSHDARGVLSMANKGSNTNGSQFFITFRPCKYLDRKHTIF 397

  Fly   335 GRIVKGSKICECIQSYGTKNG 355
            ||:|.|......|:...|:.|
 Worm   398 GRLVGGQDTLTTIEKLETEEG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 30/161 (19%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 31/167 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.