Sequence 1: | NP_724715.1 | Gene: | CG30350 / 246556 | FlyBaseID: | FBgn0050350 | Length: | 369 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495855.1 | Gene: | cyn-11 / 174394 | WormBaseID: | WBGene00000887 | Length: | 183 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 40/198 - (20%) |
---|---|---|---|
Similarity: | 73/198 - (36%) | Gaps: | 33/198 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 MAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSC---- 250
Fly 251 ----MCNQHSKFMVKRLFPNLWLE---------TDLMLSSDSLLHQPLEYDAKVIDHGASSYVLS 302
Fly 303 FSKAYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGT-KNGKLSRGLLFTSC 366
Fly 367 GLL 369 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30350 | NP_724715.1 | KIAA1430 | 60..155 | CDD:290590 | |
cyclophilin | 212..369 | CDD:294131 | 34/174 (20%) | ||
cyn-11 | NP_495855.1 | cyclophilin | 12..183 | CDD:294131 | 35/178 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |