DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and cyn-5

DIOPT Version :10

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001379232.1 Gene:cyn-5 / 173374 WormBaseID:WBGene00000881 Length:204 Species:Caenorhabditis elegans


Alignment Length:146 Identity:32/146 - (21%)
Similarity:62/146 - (42%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RIYFDLYLKDARPLGRFVVQLYTEAAPLVV---LQLIKSCMCNQH--SKFMVKRLFPNLWLETDL 273
            ::|||:.: ..:|:||.|:.|:.:..|...   ::|.|......:  |||  .|:..:..::...
 Worm    30 KVYFDMEI-GGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEGYPGSKF--HRVIADFMIQGGD 91

  Fly   274 MLSSDSLLHQPLEYDAKVID------HGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRV 332
            ....|....:.: |..|..|      |..:.::   |.|.....|:...|.|:......::|..|
 Worm    92 FTRGDGTGGRSI-YGEKFADENFKLKHYGAGWL---SMANAGADTNGSQFFITTVKTPWLDGRHV 152

  Fly   333 GFGRIVKGSKICECIQ 348
            .||:|::|..:...|:
 Worm   153 VFGKILEGMDVVRKIE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 28/133 (21%)
cyn-5NP_001379232.1 cyclophilin 29..188 CDD:469651 32/146 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.