DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIAL4H

DIOPT Version :10

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001355057.1 Gene:PPIAL4H / 105371242 HGNCID:53889 Length:164 Species:Homo sapiens


Alignment Length:167 Identity:36/167 - (21%)
Similarity:64/167 - (38%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 IYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVK-----RLFPNLWLE---- 270
            ::||:.: |.:||||..::|:.:..|......  ..:......|..|     |:.|....:    
Human     6 VFFDITV-DGKPLGRISIKLFADKIPKTAENF--RALSTGEKGFRYKGSCFHRIIPGFMCQGGDF 67

  Fly   271 -----TDLMLSSDSLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGS 330
                 ||     |..::.....|..:|.....|.:||...|...  |:.....|.......::|.
Human    68 TRPNGTD-----DKSIYGEKFDDENLIRKHTGSGILSMVNAGPN--TNGSQLFICTAKTEWLDGK 125

  Fly   331 RVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTSCG 367
            .|.||::.:...|.|.::.:|.:|.|.|:.:....||
Human   126 HVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 Hmw_CFAP97 61..155 CDD:464014
Pro_isomerase 227..367 CDD:459694 30/153 (20%)
PPIAL4HNP_001355057.1 cyclophilin 4..162 CDD:469651 34/165 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.